SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101540|ref|YP_003553398.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101540|ref|YP_003553398.1|
Domain Number 1 Region: 5-319
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.91e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000433
Further Details:      
 
Domain Number 2 Region: 327-419
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.19e-24
Family Anticodon-binding domain of Class II aaRS 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101540|ref|YP_003553398.1|
Sequence length 420
Comment histidyl-tRNA synthetase [Aminobacterium colombiense DSM 12261]
Sequence
MADIKAPRGVRDILPEESWKWSYVLKIAAEVAKNFGYSEVHLPVFEHTELFSRGIGETTD
VVEKEMYTFEDRGGRSLTLRPEATASMVRCYLENKLNSHAQPVKLWCAGPMFRYERPQKG
RYRQFWQLDFESLGTKNPMVDVEVIALSLELYRRLGLQNLEVVINSVGCPECRPAYKEKL
KEYFKPRYEELCKTCQSRFERNPLRILDCKNPECKEITDGAPDIYTSLCDDCRCHFDKVQ
EGLSRIGAHYHIDKRLVRGLDYYTKTAYEVLSGALGAQNAVCGGGRYDNLAETIGGPFTP
SVGFATGLERIVLVMEEQNCSFGPSPDLDVYAIGLDEASREELQKLVAELRQANISTDMD
YMERGMKAQFKSADASGAVFACILGGNELANGVVNVKNLKTGEQVEVERTAVLNYIKSNL
Download sequence
Identical sequences D5EDP2
gi|294101540|ref|YP_003553398.1| WP_013047940.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]