SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101575|ref|YP_003553433.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101575|ref|YP_003553433.1|
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-25
Family GHMP Kinase, N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 166-272
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.35e-24
Family Homoserine kinase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101575|ref|YP_003553433.1|
Sequence length 302
Comment homoserine kinase [Aminobacterium colombiense DSM 12261]
Sequence
MRLFRVKVPASSANLGSGFDTLGLGLSLYNFFDVRAFLKKGSYVLEIIGEGSGELGRENN
ALIQSYEFACNKWGIDPPGLDLCSLNAIPMARGLGSSSTAIVAGVAIANTLRENSLQKDE
LLSLMVELEGHPDNVVPCCMGGMVVSGVDGGIIRFVKMPPLPEDMVAVVAVPEVRVSTQS
AREALPTKVFLKDAVYNISRAALLAASWSTGNWSNLPWAMGDRLHQPFRARLFPGGEEIL
RELSNAPNCSGVAISGSGPSMIAFARGLAGDIAKLMCSIFSRHGIRSRFFVLREDREGLS
IF
Download sequence
Identical sequences D5EDS7
WP_013047975.1.58668 gi|294101575|ref|YP_003553433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]