SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101591|ref|YP_003553449.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101591|ref|YP_003553449.1|
Domain Number 1 Region: 79-204
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.23e-26
Family Transcriptional repressor Rex, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 6-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.25e-18
Family Transcriptional repressor Rex, N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101591|ref|YP_003553449.1|
Sequence length 209
Comment CoA-binding domain-containing protein [Aminobacterium colombiense DSM 12261]
Sequence
MKIAEPTVERLVQYHRLLEQLYNEGQKVVSSQEIGEMLAFKASQVRKDLSYFGEIGKRGV
GYHVEKLYRHIDGILASPRKWPIALIGVGRLGEALLGHKAFKSPKFDIKALFDVNPEKVG
RKIAGISCYHVDDISDVMRKNGIEVVILTVPSSVAQECVDKIVQAGTVKGILNFSPLSIV
APDSVLIYSVDISVELEKLLFYLKHREER
Download sequence
Identical sequences D5EDU3
WP_013047991.1.58668 gi|294101591|ref|YP_003553449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]