SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101612|ref|YP_003553470.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101612|ref|YP_003553470.1|
Domain Number 1 Region: 41-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000243
Family Cold shock DNA-binding domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101612|ref|YP_003553470.1|
Sequence length 499
Comment ribonuclease, Rne/Rng family [Aminobacterium colombiense DSM 12261]
Sequence
MTDRKIIANTLDPEEMRVAILEKGKLVDIFVERMWERQKTGEIYKARVDSVLPGIHAAFV
NLGDGRNAFLYLNDAKGINLKPNVEVVVQVVKAARKNKGARVTSRISLPGRYLVLVPDGQ
ETGVSKRIIDEEERKRLRFLAKKLRDEGEGYGVIIRTAAEGVDEETLTHDLHTLVDLWRE
IRHDAQIQAAPCLIYRDIGLVGRVLRDELTGDVSEIVIDSEEECHKVKDYLNRILEGQEP
EVSLYEGSSPIFDFYGIERELETALDRKVWLRSGAYLIIDHTEALTVIDVNTGKYVGDTD
LRHTVLDTNLEAADEIARQLRLRAIGGIVVIDFIDMEYEEDRQKLLQRLDEVFQKDRYRA
RIFGVSQLGLVEITRKRARPDVRSVMTRGCPFCGGYGWVLKEDSVAMHIKRFLRKVSLSN
KADAMLLETHSVIAQYIADTYLAVWEEELQRRIFIAAAPEFAWNKYRLDMQGPIDVVERR
IEQMEQWEAQIRVYRTASS
Download sequence
Identical sequences D5EDW4
gi|294101612|ref|YP_003553470.1| WP_013048012.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]