SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101613|ref|YP_003553471.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101613|ref|YP_003553471.1|
Domain Number 1 Region: 1-196,1020-1127
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.51e-49
Family ABC transporter ATPase domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 468-664
Classification Level Classification E-value
Superfamily Smc hinge domain 2.35e-32
Family Smc hinge domain 0.00038
Further Details:      
 
Weak hits

Sequence:  gi|294101613|ref|YP_003553471.1|
Domain Number - Region: 349-516
Classification Level Classification E-value
Superfamily Tropomyosin 0.000105
Family Tropomyosin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101613|ref|YP_003553471.1|
Sequence length 1139
Comment SMC domain-containing protein [Aminobacterium colombiense DSM 12261]
Sequence
MFIERLRLKGFKSFGGSHELTFSPGFTAIVGPNGSGKSNILDGLRWVLGEGSPNCLRITR
QSDLLFQGSISLPTATETEVSLCIREDPKICTIKREFSPETGTSLFVDGMRIRLQDLDDV
KRQWHMEGEQFAFIGQGEVAEAIHHRPQQRRSILEALFGIDQYRKKREDANQKLKFASEE
LARLETLVSELTSRRDEIAAMVTIAEKARRLLDELDEKRRGYYFSRRAFLERELYSFQSR
IHALERRKNRAAEWETIWKEGLSFYQSLFNSYEQQKKVHEERTESLGFQRETLRRQCFAT
ALTVKSARERLIAQKEEKRHVEEVLSKVDEEATLARGTSYSLTQNLHKKKEEVSALWQKL
SNLRSSLRAERQRRQEYGNEYARVEGECVKILSRLQARSEALDKNEKELEEAKNKVFVAE
KETETYKKEFEYTHLSYKKIIERHGEIYVQCQRLATSLSQLKKNVDVLENQLETVLENTE
QRLYPEPVRVILAAQKLGKLPIQIKLAAEAFKCEEKLAAPLEAYLGGRQFWLFVKSLEEA
QLGIELVKQKRAGRITFLPLEQCHPRNPDYGFPLPCQGTVGWATDLIASEQLWSPAVNHL
LGDLLIVEEYDVGMNLARAGASFPIVTLQGDVFTVGGSVSGGKFRKTGGAIERRLQIEDL
EKNLKDKRGSLERVVSLLQEAEELECVIAKERAFWKEKEQEAEKKLLSHSIRFERQREEI
VRLEKERSFFLNDVEDSGKLLKRTQHSLKELEEAIASFGDFPDETELERELASAKGEEAV
LCEKVKSGEVLINRIESEAAQLTERLRSLSGELENTELSLDEGLDRLRELGVQSYELWEN
IKEIDSERARLSAETESLVERTSLLRERCAEAHERVQIEEEKVKDSQRQVDSARLELNQI
ISLWEDAYHYPGTENISLEEYEEESLAHVRRLEKKVRELGDYDLGVLSENESLKNRLAFL
TVQIEDVHGGIGELQSLIQSTDERVGLLFGEALKNTDERFNSLFQRLFGGGEAHLELEEG
LSLWEAGVDIFARPPGKRLQNLAQLSGGEQSLTAIALLFATMEVAEVPLAILDEVDASLD
EYNLLRFIDLVSDYAMHMQILAMTHRRSTMERADVLYGVTMDEPGLSKVIGVHLDEWTE
Download sequence
Identical sequences D5EDW5
gi|294101613|ref|YP_003553471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]