SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101616|ref|YP_003553474.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101616|ref|YP_003553474.1|
Domain Number 1 Region: 3-347
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.65e-115
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000201
Further Details:      
 
Domain Number 2 Region: 350-554
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.06e-43
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00011
Further Details:      
 
Domain Number 3 Region: 536-642
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.41e-31
Family Myf domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101616|ref|YP_003553474.1|
Sequence length 643
Comment methionyl-tRNA synthetase [Aminobacterium colombiense DSM 12261]
Sequence
MSEKSFYITTPIYYVNDIPHIGHAYTTIAADVMARYRRMMGDRVFFCTGTDEHGQKIQQS
ADAKGMTAKELADRTMENFRRLWEVLNISNDDFIRTTEERHEKVVQGIFKKLMDQGDIYK
GTYEGWYCIPCETYVPESSMKEDKTCPDCGRPLQKMEEESYFFRASKYSDQLLDYYEKNL
KAIMPRSRYNEIVSFVRSGLRDQSVSRTSIKWGIPVPGDEKHVVYVWFDALINYLTACGY
MSDSEKLNIFWPSVHHLVGKDIIRFHCVIWPIMLIALGLNPPVTVFAHGWWTVEGEKMSK
SKGNVVDPFEMADVYGVDPFRYFVLREVPFGLDGDFSEQAMVLRINSDLANDLGNLLNRT
LQMVKNFRDGIVPAPTNFESLDKEIETLLQSTFSQVEESMSCFAYEEALKAIWALIRRGN
KYIDETMPWKLGKEGPQERLDTVLFVLAEMLRGTGLLIAPFMPLTAEKLWGQLGLPGTPE
KHGIPAFSFGGFPAGTQTIKGDVLFPRIDVENWKKERAEREARKGSVPDPGNHEEQIMIE
DFAKVELRVGQIIAVEEIPKAKKLYKLHVDLGYEKRTIVSGIKEHFSVEELLGKRIVVVV
NLKPVKLCGVESRGMLLASGPADKSTLALLTPDKDIPLGSRVS
Download sequence
Identical sequences D5EDW8
gi|294101616|ref|YP_003553474.1| WP_013048016.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]