SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101625|ref|YP_003553483.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101625|ref|YP_003553483.1|
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-107
Family G proteins 0.000000017
Further Details:      
 
Domain Number 2 Region: 476-596
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-44
Family Translational machinery components 0.00000813
Further Details:      
 
Domain Number 3 Region: 246-272,302-398
Classification Level Classification E-value
Superfamily Translation proteins 2.42e-34
Family Elongation factors 0.00018
Further Details:      
 
Domain Number 4 Region: 600-686
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.28e-31
Family EF-G/eEF-2 domains III and V 0.0000495
Further Details:      
 
Domain Number 5 Region: 401-478
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.47e-24
Family EF-G/eEF-2 domains III and V 0.0000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101625|ref|YP_003553483.1|
Sequence length 687
Comment translation elongation factor G [Aminobacterium colombiense DSM 12261]
Sequence
MHNIEMKKIRNIGIAAHIDAGKTTTTERILFYTGRNYKMGETHEGSATMDWMEQERERGI
TISSAATTCIWRDCFVNIIDTPGHVDFTVEVERSMRVLDGAVAVFCAVGGVEPQSETVWR
QADKYHVPRIAFVNKMDRVGADFYQVVNGIRTRLGARSVPLQLPIGSEDRFSGIVDLIQM
KAVFFQDDLGTAPVVGEIPGELMADVKKARDLLIENLADFDESVMESYLEGQDVPEETLR
RAIRENTIQQRIVPVLCGSAFKNKGIQLLLDAVVDYLPSPLDLPPIIGVDPKTEETVERH
SDMNEPLTALGFKIMVDPFVGRLVYTRIYSGKLVKGSTVYNPVTNTRERVGRILRMHANK
REELDEAGAGMIVALPGLKATRTGDTLCDESHPVVLESLQFPDPVISLAVEPATKNDKIK
LTKGLVALAEEDPTFKVRTDEETAQTIISGMGELHLEIIVDRLKREFGVDVKVGRPQVSY
RETIRKSSRAEGRFVRQSGGRGQYGHVVFEMAPLEDGKGFAFEDKIVGGVVPKEYIAAVQ
KGLDEAVNNGILGGFPVIGVKVALVDGSYHEVDSSEMAFKIAASMGFKEAMKKADPVLME
PIMSVEVVTPEDYVGDVIGDISSRRGRIEGMETKTNTRVIRSFVPLSEMFGYATDLRSKT
SGRATYSMQFDHYEQVPAEIAEKILKS
Download sequence
Identical sequences D5EDX7
gi|294101625|ref|YP_003553483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]