SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101626|ref|YP_003553484.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101626|ref|YP_003553484.1|
Domain Number 1 Region: 9-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-61
Family G proteins 0.000000189
Further Details:      
 
Domain Number 2 Region: 304-399
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.82e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000735
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Translation proteins 3.34e-32
Family Elongation factors 0.00000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101626|ref|YP_003553484.1|
Sequence length 400
Comment translation elongation factor Tu [Aminobacterium colombiense DSM 12261]
Sequence
MAKEKFERAKPHLNVGTIGHIDHGKTTLTAAITKCLSTKGWSNFEAYDMIDKAPEERERG
ITINISHVEYQTENRHYAHIDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHV
LLARQVNVPAVVVFMNKTDQVDDDELLDLVEMEIRELLSKYDFPGDDVPIIRGSALKVLE
EGTGEENDPVSKCIWELMAACDSYIPAPQRETDKPFLMPIEDVFTITGRGTVVTGRVERG
MIKSGEEVEIVGMKADTTKTVATSLEMFRKILDEAIAGDNVGILLRGIDKEDVERGQVLA
KPGSITPHTKFKAEVYVLKKEEGGRHTPFFAGYKPQFYFRTTDVTGGIKLPEGVEMVMPG
DNATFEVDLIVPIAMEAGLRFAVREGGHTVGAGVVTEILA
Download sequence
Identical sequences D5EDX8
WP_013048026.1.58668 gi|294101626|ref|YP_003553484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]