SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101652|ref|YP_003553510.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101652|ref|YP_003553510.1|
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.39e-29
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101652|ref|YP_003553510.1|
Sequence length 73
Comment translation initiation factor IF-1 [Aminobacterium colombiense DSM 12261]
Sequence
MANKDDVIEVRGTVIEPLPNAMFRVELENGHKILAHVSGKMRMHFIRILPGDKVLVEISP
YDLTRGRIVYRYK
Download sequence
Identical sequences D5EE04
WP_013048052.1.58668 gi|294101652|ref|YP_003553510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]