SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101690|ref|YP_003553548.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294101690|ref|YP_003553548.1|
Domain Number - Region: 30-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000133
Family Extended AAA-ATPase domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101690|ref|YP_003553548.1|
Sequence length 312
Comment DNA polymerase III delta [Aminobacterium colombiense DSM 12261]
Sequence
MPKIVIISASEVSQRRLLSKTLQKYTIQGYSLSGRKEGGSWQDILSLGKNRVLFSEKQML
LVENAENLGVLPESMITFFNSVEESCLVLLVYDGSPSKYIPKEALQRAEILKAEEIPFWP
SARLRWLLNFCGDRRINLEKEAAALLIDWIEDGEELRSEIEKIAAFSDGQTVTSEMVRAL
SFDEGRSSMLRFLDGVCQGNRKEILILFPHLHQDVPFLMLVTALYNRLKPVIYQYIFPSL
SEKDILEMLKVRSYAGKMASEARKNYDKQTLFAFIVELTGLSYGEKTGAGAGWAGLETIV
LRLIGSIKKEKS
Download sequence
Identical sequences D5EE42
WP_013048090.1.58668 gi|294101690|ref|YP_003553548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]