SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101702|ref|YP_003553560.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101702|ref|YP_003553560.1|
Domain Number 1 Region: 292-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.02e-48
Family Ribonuclease PH domain 1-like 0.0000162
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.85e-46
Family Ribonuclease PH domain 1-like 0.0000226
Further Details:      
 
Domain Number 3 Region: 136-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.06e-27
Family Ribonuclease PH domain 2-like 0.0012
Further Details:      
 
Domain Number 4 Region: 449-543
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.02e-26
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.63e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 617-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.51e-19
Family Cold shock DNA-binding domain-like 0.00071
Further Details:      
 
Domain Number 7 Region: 240-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000136
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101702|ref|YP_003553560.1|
Sequence length 748
Comment polyribonucleotide nucleotidyltransferase [Aminobacterium colombiense DSM 12261]
Sequence
MKKVFSIEIGGHEMTFETGCVAKQANGSIVARSGDTVVLTTTCISDTPRTGIDFFPLLVD
FEERYYSAGKIPGGFIKREGRPTENAILSARVIDRSIRSLFDENLRYDIHVVATVLSVDQ
LNPPSVLAINAASVALMISEIPWGGPIGAVRIGYINDQLVVNPLEEQMLESKLDLLVSGH
KDGITMVEAGANEVSEELLVDALDLAHTEIKKIVAMQEEIRKQIGKEKIDIPEPEFFEEI
DSWLGAEMQKHVLEAVSIHEKKPRAEKIRYVKTTSIEHFAENYPGTEAYISAAVDEMVKK
TMRSRILNERERADGRAMDEIRPITCEVGVLPRVHGSALFTRGETQALVVATLGMMGVDD
QILDGLKQDEPNKRFILHYNFPPYSVGEVRPMRGPGRREIGHGALAERALRPIIPDEVEF
PYVVRLVSDILESNGSSSQASICGGSLALMNSGVPINRHVAGIAMGLIKEGEKVEILSDI
QGLEDHYGDMDFKVAGTREGVTALQMDNKAGGITREVLKKALNQAKEGRLFILEKMESAI
EEPSGLSPYAPRIYVTHIDPEKIRDIIGPGGKVIRGITQETGVKINVEDNGEVYIAGTSS
EGVERALAIIKGLTKELEPGEIYLGKVTRIMNFGAFIECLPGKEGLLHISEISPHRVGKV
EDVFGVGDTVLVMVKEIDDMGRTNLTRKKLYDQEERVIKEGFGKALEEEKAKETAIEAKA
ASAPRPAPGQRRGGSQERPDRRQGGPRR
Download sequence
Identical sequences D5EE54
gi|294101702|ref|YP_003553560.1| WP_013048102.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]