SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101715|ref|YP_003553573.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101715|ref|YP_003553573.1|
Domain Number 1 Region: 290-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.79e-38
Family ABC transporter ATPase domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 84-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000000405
Family DNA repair protein MutS, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 709-781
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000235
Family Smr domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101715|ref|YP_003553573.1|
Sequence length 783
Comment MutS2 family protein [Aminobacterium colombiense DSM 12261]
Sequence
MKVRKEVWNLLEIDKILSIFAKSLRSDLGLSVLTAITPCETIDTLRNRQNLLIAYRDYVD
RYGDFPWNQNVSSVAEEIHAARKTALLTGQELVAVRMLLLLATRIKDVLNQVKDEFAPFA
GVLKKIRDFKYEIESLAVLDEDGNLFDSATPTLLRIRKSEEAVRQSIRLRAQALFANSRI
NNMLQERLLTFRQNRFTVLVRQEFASRFPGTFIDRSGSGNSVYMEPRSLAELNSRLVLLI
QDEEEEKRRILSELTQMILGREKAIVDAEGVLGQIDILYALTDVMGKYGWTLPELSKKPF
FVFYDLLHPLLGEKGIPLTIECGRSFHVLVVTGPNTGGKTVALKTVGMGIILAWCGFPLP
AKEGTVVGNLDNVFADIGDEQSIEQNLSTFSAHLKNIIHILSEATRSSLVLLDELGAGTD
PQEGAALGIALIDTLREKKSITLATTHHNPIKSYALTTPHVETASMEFNVETLAPTYHLL
MGIPGRSNAIYIAERYGMPSEVLQKARATLKEQEISMEEVIADLHERKALLNHEWEKMEE
QRQKADLLSKEYSEKMKALEEQREKIIAKAEQQAATVLASAEEESRRMIRDLDEAARSVV
QRNLHGKRENIREKRKELEQKEEKRFIKKMKDEKRNLEIGDAVSIAGTSITGTILALKGN
KAEVQAGAARMDVPLISLTPTSKKVRDALPESPAMSATKPQGVPLSLMIRGMTVDEAMPL
VEQYLDRAMRAGYLSVEIIHGRGEGILRREVHQFCAHLSYVESYRLGGPGEGGHGVTIVT
FKK
Download sequence
Identical sequences D5EE67
gi|294101715|ref|YP_003553573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]