SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101730|ref|YP_003553588.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101730|ref|YP_003553588.1|
Domain Number 1 Region: 33-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.03e-57
Family Extended AAA-ATPase domain 0.0000111
Further Details:      
 
Weak hits

Sequence:  gi|294101730|ref|YP_003553588.1|
Domain Number - Region: 262-342
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.00221
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101730|ref|YP_003553588.1|
Sequence length 554
Comment DNA polymerase III subunits gamma and tau [Aminobacterium colombiense DSM 12261]
Sequence
MTVSLYRRYRPAQFKQIVAQDAAVQVITKALEEKRVSHAYLFSGPRGCGKTTLARLLAKS
LNCTGQKQSVEPCNDCPNCLAINGGESLDVIEIDGASNNSVDEVRELKAHVSLSAFSSLY
KVYIIDEVHMLSLSAFNALLKTLEEPPSHVVFILATTEPHKVPVTIRSRCQHIPFRKIDV
QNIVKSLSMVAHNENRNAEEEALWEIARQADGAMRDALSLLEQVMALAEQELRLVDVSRL
LGGGSRPELERWVSRVRSGDISVFSELQEMFQRGASPQKVVEDLFVIFRDLWIVASWGGG
ALQFIEGSSKEKIFLEQESKDWNPDHLLKIMDFCAQILPQVRMGMRSDVLSGLFLNKLIE
HGSLVTKELEKTREPHSLPPEDHPAFKEKWGKVLASLLYGEIHIYCALLHASVFLEKNVL
SLKFPDYCNYSMELVSIERNSFVLQQKIKEIFEGELTLRIICGDKTTECDLSQSPLLAEI
EEAIVEIQDEPTSSLPFDDLPPTAEIRPEFGNEQEDDETVFSGLVDTVLRWGGGEVLLHK
KDNVEELDGGITEE
Download sequence
Identical sequences D5EE82
gi|294101730|ref|YP_003553588.1| WP_013048130.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]