SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101756|ref|YP_003553614.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101756|ref|YP_003553614.1|
Domain Number 1 Region: 14-211
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.37e-45
Family G proteins 0.0000983
Further Details:      
 
Domain Number 2 Region: 186-305
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.57e-37
Family Prokaryotic type KH domain (KH-domain type II) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101756|ref|YP_003553614.1|
Sequence length 308
Comment GTP-binding protein Era [Aminobacterium colombiense DSM 12261]
Sequence
MREAAMNFKFGVVPIVGRPNVGKSSLLNNILAYKVSIVSEKPQTTRNAIHGIYNEPEMQI
VFTDTPGIHRPRHKLGEALVKAAVRSLENADLILYVVEVDDISISPEDDRIIEILQEVST
PIFLVVNKIDQVQQSERRLMAVASLFKEKLPIVGALGVSAKKGYNIDKLVQILKDKLPAG
FPWYDEEILTDRPERFLAGEIIREKVLLLTHEEVPHSVAVEVEEYKSPDEYPERDVLYIR
ANLVVEREGQKTILIGKKGSKIKKIGSLARSDIETMTGHRVFLDLWIKVRPAWRKSEGEL
WRMGYIER
Download sequence
Identical sequences D5EEA8
gi|294101756|ref|YP_003553614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]