SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101779|ref|YP_003553637.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101779|ref|YP_003553637.1|
Domain Number 1 Region: 9-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-127
Family Tandem AAA-ATPase domain 0.000000000315
Further Details:      
 
Domain Number 2 Region: 36-80,468-588
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-35
Family Tandem AAA-ATPase domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 621-649
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000615
Family C-terminal UvrC-binding domain of UvrB 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101779|ref|YP_003553637.1|
Sequence length 682
Comment excinuclease ABC subunit B [Aminobacterium colombiense DSM 12261]
Sequence
MSGIFNLKADWGPSGDQPEAIEKLVESLKNGTRFQTLLGVTGSGKTFTVANVLAQFDRPV
LVLAHNKTLAAQLYTEFKTFFPHNAVHYFVSYYDYYQPEAYIPSSDTYIEKDASINDRIE
KLRLAATKALVERRDVIVVASVSCIYGLGKKEMYEEVIFPFAVGEKWDRRGFMERLIDNY
YARNDMLLEAGKFRARGDVLEIYPSYSETALRVAFFDDEIERIDEIDPVSGHTLKQLPKA
SIFPAQHYVTSRDAIDKAMGQIQQELDEQLHLLKKQGKLLEAQRLEMRTRYDMEMLAEVG
YCSGIENYSRYLDGRNPGEPPGTLLDFFPDDFIMVIDESHITLPQVRGMYNGDRARKTTL
VENGFRLPSCLDNRPLNWREFKKYLRQVIFISATPGDWEREVSTCVAEQIIRPTGVVDPE
VVVSPATGQVDDLVDRLRGITARGERALVTTLTKKSSEDLAEYLADLQFKVKYIHSELNA
FERAELIRDLRSGEVSILVGINLLREGMDLPEVSLVAILDADREGFLRSHRSLIQIMGRA
ARNTRGQVVLYADVETESIRTSVQETRRRREIQMLFNEKHGIIPQTISKTVQNLLPEEFT
SDAVKLESRRGKRTKEVQEYTHSDLERLMWEAVEKLDFEKAAQIRDILTDSKGKEWQRVA
SYQHKRSKRAQSQKYKRNTSKK
Download sequence
Identical sequences D5EED1
WP_013048179.1.58668 gi|294101779|ref|YP_003553637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]