SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294101791|ref|YP_003553649.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101791|ref|YP_003553649.1|
Domain Number 1 Region: 32-123
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000139
Family YjeE-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101791|ref|YP_003553649.1|
Sequence length 166
Comment hypothetical protein [Aminobacterium colombiense DSM 12261]
Sequence
MINKKEEKADSMEITSFSPEQTRLIGECMARHVYSGLTILLYGDLGAGKTVLVKGLGDGL
GARGVRSPSFTLINEYEGRLPLAHVDLYRLERGDEYELGLCEYADDGFVLVIEWPDRLAE
QPTKDLWKLYFCRDSETVRRISFKAEGEKAVKTMELLLKDIGEIGQ
Download sequence
Identical sequences D5EEE3
gi|294101791|ref|YP_003553649.1| WP_013048191.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]