SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101862|ref|YP_003553720.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101862|ref|YP_003553720.1|
Domain Number 1 Region: 65-134
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.95e-17
Family DNA helicase RuvA subunit, middle domain 0.0051
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000274
Family DNA helicase RuvA subunit, N-terminal domain 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|294101862|ref|YP_003553720.1|
Domain Number - Region: 151-200
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.000159
Family DNA helicase RuvA subunit, C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101862|ref|YP_003553720.1|
Sequence length 201
Comment Holliday junction DNA helicase RuvA [Aminobacterium colombiense DSM 12261]
Sequence
MLRSLEGKVLHIGEENVILDVNGLGFDILCSGSALRLCEDNETIRLTTYLQVSENGATLF
GFSSEQEREVFIKLLTVKGVGGRVGLAVLRTLSPTQVIRSVATSDTDTFLQVPGVGKKTA
ERLCFELKRHLSEEMLAEFAEEEVPSILVKNTVAAALRSLGFTQNEVYSVMNRLKREMGS
EFDTTKEDILLKRALRELKRN
Download sequence
Identical sequences D5EEL4
gi|294101862|ref|YP_003553720.1| WP_013048262.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]