SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101957|ref|YP_003553815.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101957|ref|YP_003553815.1|
Domain Number 1 Region: 9-244
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.13e-58
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.00015
Further Details:      
 
Weak hits

Sequence:  gi|294101957|ref|YP_003553815.1|
Domain Number - Region: 252-365
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00863
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101957|ref|YP_003553815.1|
Sequence length 434
Comment DNA-directed DNA polymerase [Aminobacterium colombiense DSM 12261]
Sequence
MKHVAVKPIVLCDCNNFFVSCERIYRPDLQKKPVIVLSSNDGCVVSRSNEAKALGIPMGV
PFFQVEKACRHYGIAVFSSNFELYQDISSRVIAVMKDNAPTVEVYSIDEAFLTFDLSSYA
HIEEKMAQIHKQVYQWVGIPVSIGAASSKTLTKLAAEYGKKHEETGGCYSLLSLASEEMT
NFLERVPVGNIWGIGKQLAMRLGKHRIRTARELRDVRDERIMKIIGMPGVKTAWELRGIP
CIKIKEAETLQKTLQVSRSFGREIKDVDGIAAAITHFVSSAGIRLRQEKALAGAISVYIT
TNPFLTPYYSNSVSIPAPYPTNYTPQLIKLALLGLDRIYKPGYYYTKAGVTLEDLSSRSY
MQRYLFAKDEGDDADKKQTLMDVVDAINENVGEKIISPAILHFNEGKEWAPRSNLKSPAY
TTRWEDVPYVETAD
Download sequence
Identical sequences D5EEV9
WP_013048354.1.58668 gi|294101957|ref|YP_003553815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]