SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101966|ref|YP_003553824.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101966|ref|YP_003553824.1|
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 1.1e-34
Family Transcription factor NusA, N-terminal domain 0.0000567
Further Details:      
 
Domain Number 2 Region: 203-280
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.99e-29
Family Prokaryotic type KH domain (KH-domain type II) 0.00011
Further Details:      
 
Domain Number 3 Region: 135-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000351
Family Cold shock DNA-binding domain-like 0.0045
Further Details:      
 
Domain Number 4 Region: 282-344
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000000000000235
Family Prokaryotic type KH domain (KH-domain type II) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101966|ref|YP_003553824.1|
Sequence length 362
Comment NusA antitermination factor [Aminobacterium colombiense DSM 12261]
Sequence
MQLGRDFVRALKQLTAERGLTSEVIASSLEAALISAYKKYQGGDRNVEVHIDLESGNVSI
YEVRLVVDEVDNPDAQISLIDVQKLGFTDVEVNEYVRIEKNPENFGRIAAQTARQVIIQK
LKDAERQIIFEEFSGRVGDLVNGIIFKSENDQVLVRLNDRTEAILPKEERVINEKYTPGE
RLKFYLLDVRQTTRGPRIVVSRTHPGLLRKLLELEVPEIQEGIIEIKSIVREAGTRAKVA
VQTLDINVDPVGACVGNNGARIKSISQELSGEKIDVIIWSSDPLIFVRNSLSPAKIVKIE
PILEQDKAVTVYARPDQLSLAIGKAGQNVRLAARLTSWKIDIKALEPERMPTLQDIFQDI
IE
Download sequence
Identical sequences D5EEW8
WP_013048363.1.58668 gi|294101966|ref|YP_003553824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]