SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101976|ref|YP_003553834.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101976|ref|YP_003553834.1|
Domain Number 1 Region: 80-356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-77
Family RecA protein-like (ATPase-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 8-73
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000863
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101976|ref|YP_003553834.1|
Sequence length 459
Comment H(+)-transporting two-sector ATPase [Aminobacterium colombiense DSM 12261]
Sequence
MRLALEGYRSVFGIAGPLIFVSGIREAGYSELVRIETPYGLRSGQILQIQDDICVIQVFD
GTMGLNTGETTVWLERDVVKMPVGLSLVGQVLNGRGRSIDGTPLSFIDKDLPITGMPINP
VRRTSPNAYVETGISSIDMMNTLVRGQKLPIFSGSGLPANEIAAQIVQQAAVPGRETDFL
VIFAAMGITRREARYFIDTFESTGAINNGIFFMNLASDSAVERLLTPRMALTAAEYFAFE
KGYDVLVIMTDMLYYCESLREISAAREEVPGRRGYPGYMYSDLAEIYERAGCVENCQGSI
TQIPIITMPDDDMTHPVVDLSGYITEGQIVLDRGIHDRGAYPPINVLPSLSRLMNKGIGK
GKTFDYHRALADQLYASYARALELSRLRLIVGDDGLTETEHLYIKFGENFERNFVNQRHI
HRTIAESVNVAWQCLSELPVRELYRLPEHYITEKLGRHE
Download sequence
Identical sequences D5EEX8
WP_013048373.1.58668 gi|294101976|ref|YP_003553834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]