SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102010|ref|YP_003553868.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102010|ref|YP_003553868.1|
Domain Number 1 Region: 6-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000126
Family Nitrogenase iron protein-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102010|ref|YP_003553868.1|
Sequence length 253
Comment putative ATP/GTP-binding protein [Aminobacterium colombiense DSM 12261]
Sequence
MNNRLTLLASLIRLYEWPKAVAVTGALGSGKTEWVLNMALALLEAGEKVTIADIDIINPY
FCIRQVSDVLEKKGLSVITMPEQAKWLDMSLVTPKVDWALHDESTRLLMDIGGDAEGALA
LKQFEPIIKKVGYRLILVVNAFRPQTASVTRIQKMMKKMESICGLEVGALISNSHLMHET
TVHDAIEGIKTVYDAGQNLDLPVLYAGVNPSLVPDVKRVLGEGYPVPIWPLSRYMLLPWE
DGFMWSRQTEESN
Download sequence
Identical sequences D5EF12
WP_013048407.1.58668 gi|294102010|ref|YP_003553868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]