SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294102015|ref|YP_003553873.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102015|ref|YP_003553873.1|
Domain Number 1 Region: 8-163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000857
Family Extended AAA-ATPase domain 0.061
Further Details:      
 
Weak hits

Sequence:  gi|294102015|ref|YP_003553873.1|
Domain Number - Region: 7-39,174-236
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0012
Family Extended AAA-ATPase domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102015|ref|YP_003553873.1|
Sequence length 319
Comment tRNA delta(2)-isopentenylpyrophosphate transferase [Aminobacterium colombiense DSM 12261]
Sequence
MMKGKLPILAIIGPTAVGKTKLSLEIAETLKAEVISVDSRQVYRYMNVGTDKVTFQTRQH
ILHHMLDVVDPDEVFSAADFVDKSMAAIERIMNRGKIPLFVGGTPFYYHALFEGVLTKDL
PRDRKLTDELEKFASKHGNQALHDQLSAIDPKRASQLHVNDVRRVSRAIEIYKLTGQNAT
WWYSSEEKRKGYYDVLYLGLNRPRLLLFDAIEKRVHQQFDGGFIEEVEWLLHHGFDERFP
SMQGFGYKEISLYLRGKLTKEEAVEGDISATKKFCRRQMTWFKKFLPTLWYDISAYKEDD
LKRNVLEACLRHLERGNEI
Download sequence
Identical sequences D5EF17
WP_013048412.1.58668 gi|294102015|ref|YP_003553873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]