SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102017|ref|YP_003553875.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102017|ref|YP_003553875.1|
Domain Number 1 Region: 265-557
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.06e-79
Family DNA repair protein MutS, domain III 0.0000025
Further Details:      
 
Domain Number 2 Region: 558-792
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-58
Family ABC transporter ATPase domain-like 0.00000127
Further Details:      
 
Domain Number 3 Region: 6-114
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.1e-39
Family DNA repair protein MutS, domain I 0.0000194
Further Details:      
 
Domain Number 4 Region: 120-276
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 9.68e-22
Family DNA repair protein MutS, domain II 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102017|ref|YP_003553875.1|
Sequence length 858
Comment DNA mismatch repair protein MutS [Aminobacterium colombiense DSM 12261]
Sequence
MILPPNVKMTPMLSQYVEWKKKYPDCLLFFRMGDFYEMFFEDAQKASEILDIALTSRDPS
KSIPMAGVPFHAVDNYLGKLVKAGYKVAICEQVSVPDGKSLVDRRVIRIVTPGTYVPEEA
GEEGRLASINLLNDDTIALAMLSVNTGCLEAGVLKKEEALSLITGFNPGEVLIPDTIKRE
DLPVELQNFFILQRTKEQFTPDGAARWLCKIFNVPALSVFGLEEGAFDTGCAGAVLHYLE
ETQFGAIQHVTRIYPLREKHFLHLDVASQQNLELVSGDGPTLYSVLNKCKNPMGRRLLRE
WILRPLLDQDAINKRQNGVEFLVQDPVVRQKLQNLLGECRDIERASSRLSLGTGNPRDLA
AIRDTLLLIPLVYGYCKSSPLEKFISSDNSLETLSTLLASALCDEVPRHLHNGDVIRTGF
NSELDSWRELREHGDQWLDQYLEKEKAKTDIPKLKVGSNKIFGYYLEISKGNLDKVPENY
IRKQTLVSAERFITPELKEFEEKMAASEQEIASLESKIYADLVQHTLEHVQKIQDGAAML
SCIDVLASLAQVAWERNYIRPQINNGLNLKIEGGRHPVIEATFLDLPFVPNDIVLDGDEE
RIALITGPNMAGKSTYLRMAALLVIMAQMGAFIPAAEASMGLMDRVFTRIGARDELSRGN
STFMVEMIETANILHNVTDRSIVVLDEIGRGTSTYDGMSIAWAVLEYLDHGCGSKPKVLF
ATHYHELVALEDHLNGLKNLSMAVHEGERGISFLYKVVDGPADRSYGIEVARLAGIPPAV
LKRAFHLLETFERADEVKPSGGVMETSQQIQLFPVSSQAIIEELAAIDPNKMTPFRALEM
MYKITDQCREELQSHGNT
Download sequence
Identical sequences D5EF19
gi|294102017|ref|YP_003553875.1| WP_013048414.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]