SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102028|ref|YP_003553886.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102028|ref|YP_003553886.1|
Domain Number 1 Region: 132-188
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.15e-17
Family Cold shock DNA-binding domain-like 0.00042
Further Details:      
 
Domain Number 2 Region: 69-132
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.43e-17
Family Cold shock DNA-binding domain-like 0.0073
Further Details:      
 
Domain Number 3 Region: 5-66
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.43e-16
Family eIF5a N-terminal domain-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102028|ref|YP_003553886.1|
Sequence length 190
Comment translation elongation factor P [Aminobacterium colombiense DSM 12261]
Sequence
MSQVIDTSDFYSGIKVKWQDGIWEIIDYQHHKMGRGGAVIRTKLRNVETGSSVETTFRSG
EKFERVIYDEKAAQFLYQEGDSYVFMDMGTYDQLYIHKDVLGDAINYLTDNLEVQIEYFE
ERVMGIDLPKSVELQVIDTPPGYKGDTVSSGGKPATLETGITITVPIFINIGDTVVVDTR
SGEYLERAKK
Download sequence
Identical sequences D5EF30
WP_013048425.1.58668 gi|294102028|ref|YP_003553886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]