SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102058|ref|YP_003553916.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102058|ref|YP_003553916.1|
Domain Number 1 Region: 76-181
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.00000000000181
Family PaaI/YdiI-like 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|294102058|ref|YP_003553916.1|
Domain Number - Region: 8-59
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00015
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102058|ref|YP_003553916.1|
Sequence length 192
Comment hypothetical protein [Aminobacterium colombiense DSM 12261]
Sequence
MVIRSKKKKQRQGKLLKLLEQNPLYTDKELADALSASVSTIRLDRALLGVPELRERTINM
AQRATSKLRSLKQSEVVGDLLELEPNKWALSVLQTKKEMAFRHTDYVCDHYIYSQASSIA
IAVVEADMVIIDSMRGEYKSHAKVGDVLIARAKVGVHKDNKYIVSVRTRVGDQEIFVGRF
IAVVIDSLEMKS
Download sequence
Identical sequences D5EF60
WP_013048455.1.58668 gi|294102058|ref|YP_003553916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]