SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102071|ref|YP_003553929.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102071|ref|YP_003553929.1|
Domain Number 1 Region: 145-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000867
Family Tandem AAA-ATPase domain 0.037
Further Details:      
 
Weak hits

Sequence:  gi|294102071|ref|YP_003553929.1|
Domain Number - Region: 336-382
Classification Level Classification E-value
Superfamily CHY zinc finger-like 0.0536
Family CHY zinc finger 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102071|ref|YP_003553929.1|
Sequence length 604
Comment primosomal protein N' [Aminobacterium colombiense DSM 12261]
Sequence
MTLIDVIVPGPWWNPLTYEHEEAVPAGNRVQVPVGPAKRVGFSLGVSSVTSNKSGAYRIR
TINKVLDTAAPLPRDLWILSRWIGVNFYCGQGEALRVMSPSQLMKGEEVPPAAPWECLWE
SRAFKDNYYYFPEDQERHARYLKILQEHPGPAILLFPERALAEFFYSFLETEGVENIFLW
PSVGGKKLWEAWNRTRSGEHKIIIGGPGAIFAPLPDPQLILVDEESSPAYRMQAAPLLHI
RSIAMQRARIANSSLFLCGRLPSSKVSLYKMPEEHGTSMGNRLIFVDMNRASRPSFPGIT
SSFPLSDALVRESMSCLKERKAALWILDRKGYAGEITCEECGGTLICHSCGVALRAEEEA
SRLVCPLCGYSTVFPRECPKCRGLLLSGKRPGLEIVYKVAQALCGEAFPVVEWHAEKNTS
KKAFQKVCTVLAGGGIVVGSRAAISLCDAVNVGMVGWIDADAEARKILYRSRFDAYRMVL
ESAWRGTNPSERKVVIQSRRPGSGWQRGLKYGWKAFWRRELKEREEYGFPPFNMLAEITP
PSGKKEALLQYLVDENLTIMDPGGEQNSLWAFIQRPQKLKKALEPWFNISKSREGFPSVS
LWID
Download sequence
Identical sequences D5EF73
WP_013048468.1.58668 gi|294102071|ref|YP_003553929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]