SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102142|ref|YP_003554000.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102142|ref|YP_003554000.1|
Domain Number 1 Region: 86-242
Classification Level Classification E-value
Superfamily PRTase-like 1.84e-25
Family Phosphoribosyltransferases (PRTases) 0.00016
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000639
Family N-terminal domain of Bacillus PurR 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102142|ref|YP_003554000.1|
Sequence length 263
Comment phosphoribosyltransferase [Aminobacterium colombiense DSM 12261]
Sequence
MKGQRTERLIRTVCRFLTTPSRQISLTALSNDFGVSKTVISDDVVLIDSALTQEGLGGIQ
VDRGRTGGASFIPSMSENVKGQLFLEIKDLLSQEDRILPGGLIYYSDILFNPYYASRLGL
IMATYFQATKPDIVMTTEVKGIPLGLFTAHALGVPLAVCRFRNRPSDGSAVAVHFPTKTG
EVRAMYMGTKQLERGSRVLIVDDFMRGGSTAAGMLLVAKEFGAEVCGIGVFLASAEPEIK
AVSDYTALFSLKSMGKSTPEVAF
Download sequence
Identical sequences D5EFE4
WP_013048539.1.58668 gi|294102142|ref|YP_003554000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]