SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102145|ref|YP_003554003.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102145|ref|YP_003554003.1|
Domain Number 1 Region: 5-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.81e-46
Family G proteins 0.0000369
Further Details:      
 
Domain Number 2 Region: 272-364
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.48e-22
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.008
Further Details:      
 
Domain Number 3 Region: 180-266
Classification Level Classification E-value
Superfamily Translation proteins 2.5e-22
Family Elongation factors 0.00048
Further Details:      
 
Domain Number 4 Region: 594-635
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000141
Family C-terminal fragment of elongation factor SelB 0.0037
Further Details:      
 
Domain Number 5 Region: 445-515
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000264
Family C-terminal fragment of elongation factor SelB 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102145|ref|YP_003554003.1|
Sequence length 646
Comment selenocysteine-specific translation elongation factor [Aminobacterium colombiense DSM 12261]
Sequence
MNEKEISLVLGTAGHIDHGKTTLVKALTGVSCDRLNEEKKRGITIELGFAPLKLHDGRVV
SIVDVPGHEKFIRQMVAGASGIDAVMLVVAADEGVMPQTREHLAILNLLGVHDGVIVISK
ADLVDEELLELAIADVTDFVQGTFLEGKVVVPVSSVTNKNIPLLMEELAKLIDRVQPRTR
RGPFFMPIDRAFPISGFGTVVTGTAYKGQVGPGMEVSILPADQDVRVRSVQVHSHTVDVA
WAGQRVAMSLSGVSLDELIRGDVVCARDVYRETRCFDVELSLLTSFSEPLKHWQRVRLHV
GTADVIARVSLFDKTSLLPGESAVAQLVMEEGVVATIDQRFVIRFYSPLVTIGGGRILFA
YGKKPKGKGAKGAYKQCLEELRDAKGPKERMEILVRFHGSISRENILVDLQELPADVDEM
ARQLQKDNKIVLLASGVDCYMSQDTFAHYQHDIAAFLKAFHEERPHQAGAMIDDILTGPL
KSIERKTARLLIDFMAQKNIFVIDSNMMRLPDFVPQDDSAFFKKLDEFKIFCGNLEFQLP
LIDELQHGLSMGEKEFSLFLKDLRERGEAFVIGGKFVLAKDVEEKFITIVKEIKDDITIA
AVRDITGSSRKFVLPLLEYLDARGYTRRVGEKRVLLLHKLEQKSQK
Download sequence
Identical sequences D5EFE7
WP_013048542.1.58668 gi|294102145|ref|YP_003554003.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]