SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102211|ref|YP_003554069.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102211|ref|YP_003554069.1|
Domain Number 1 Region: 2-417
Classification Level Classification E-value
Superfamily Pentein 9e-84
Family Arginine deiminase 0.00000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102211|ref|YP_003554069.1|
Sequence length 417
Comment Arginine deiminase [Aminobacterium colombiense DSM 12261]
Sequence
MKIQVNSEIGKLRAVIMQPPGKGIERCTPLNIGALAWDAVPSPHKAEDEHKKWVATVEKF
GARVFLMEDLLRKILSVSKVKKELISQLVQTEESFITRQTMDVLQEYLLGLSAPKLVDQL
LFGITKDELNKAAGEVSLVDLVDKKNEWCLFPMSNVLYSRDPAAVLGNGIVYGNMFNRDR
IKEPYCIRAIFKHHPEFRNLEFKTWYGEDPDDATPVEGGNVHCYSPNVFIIGINERTHPA
SIEKIAQRTMEDGAITDVLALMFENPRLSSTDSIGLTVHVDMFLNMIDYDAFLFFPYIEK
KITVLHITRGKGGRLHVKRESSLFGAIKKVLKLDSIRIIKVGGDESEAVAFSEQRAGSGG
NTFNLEPGKVCIWDRNVATMKALEKGGIDVVAVEADELVKGGGGPRCSTMPLWRDDI
Download sequence
Identical sequences D5EFL3
WP_013048608.1.58668 gi|294102211|ref|YP_003554069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]