SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102232|ref|YP_003554090.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102232|ref|YP_003554090.1|
Domain Number 1 Region: 135-202
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 1.33e-18
Family FeoA-like 0.0016
Further Details:      
 
Domain Number 2 Region: 46-105
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 0.000000000000101
Family Iron-dependent repressor protein, dimerization domain 0.0028
Further Details:      
 
Domain Number 3 Region: 3-56
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000001
Family PH0730 N-terminal domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102232|ref|YP_003554090.1|
Sequence length 212
Comment DtxR family iron (metal) dependent repressor [Aminobacterium colombiense DSM 12261]
Sequence
MHGDEATVTLLSERLDVTKGTVVSAIKKLVEADMLDHERYGSVALTEKGREQALNIYRRH
AHLSFLFTEILGFDKEKAQNLACIMEHEMDSETDGRLFALTDYFCQALREGAAWFKELRV
EMDDPSRLPTPLVALKPGMKGIVNRVTSNGLLRKRLMEMGLVPGTEITFLKTSPLGDPLE
FEIGGRNLALRRSEAATVWVRRKKENESHDAT
Download sequence
Identical sequences D5EFN4
WP_013048629.1.58668 gi|294102232|ref|YP_003554090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]