SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102235|ref|YP_003554093.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102235|ref|YP_003554093.1|
Domain Number 1 Region: 4-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-42
Family G proteins 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|294102235|ref|YP_003554093.1|
Domain Number - Region: 226-294
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.0693
Family Glutamyl tRNA-reductase dimerization domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102235|ref|YP_003554093.1|
Sequence length 677
Comment ferrous iron transport protein B [Aminobacterium colombiense DSM 12261]
Sequence
MGNITLALAGNPNTGKTSLFNLLTGSRQHVGNWPGVTVERKEGHFSYEGMNFTLVDLPGI
YSLGAASIDEQVASEFLIKEKPELAITVVDASNLERSLYLVVQMLEAGQPLIIALNMADV
AENKGIRIHREKLEKALGVPVVPTVARERKGLEDLVKRVKDRFENGVSLSLLAIPYGEKV
EQSLDRIAKNVSSALLREANIDRRLASIKIAEGDPLIISMLEKLGEAKEVTAIVEEENER
LELELGYDLLTAVIERRWNFISAITQKVAERNLSLKKNLSPSDKIDRIVTHKIWGLPIFL
IITWFMFRFTYAVGDPIADYLDGTISALGERIAFLMETAGFPLFAGSFVADGVIGGVGSI
VVFFPHIMVLFAFIAILEDSGYMARGAFVMDRIMRAMGLHGKSFIPMLMGFGCNVPSIMA
TRVLERPRDRMITLLVLPFMSCSARLPVYLLFAGIFFGNHAGTIVFSLYVLGIAIAVISA
KVLGSTLFKGESSQFVMELPPYHLPQAGSVLKSAWERASLFLKKAGTVIFGAVIIVWVMA
SLPLGVEYGSHESIVGRIGDMLAPLFAPAGFGFWQAGVALFFGFFAKEIVVGTLGTLLAG
GEAGLASALPALFSPLSAYAFLVMTLLYVPCIAAVAAFKRETNSWKWTFFMIAYTTLIAY
GAAVIVYQGGQLLLGLS
Download sequence
Identical sequences D5EFN7
WP_013048632.1.58668 gi|294102235|ref|YP_003554093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]