SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102246|ref|YP_003554104.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102246|ref|YP_003554104.1|
Domain Number 1 Region: 447-853
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.33e-119
Family DNA polymerase I 0.0000000298
Further Details:      
 
Domain Number 2 Region: 7-174
Classification Level Classification E-value
Superfamily PIN domain-like 2.35e-49
Family 5' to 3' exonuclease catalytic domain 0.0000346
Further Details:      
 
Domain Number 3 Region: 176-286
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 6.43e-31
Family 5' to 3' exonuclease, C-terminal subdomain 0.00025
Further Details:      
 
Domain Number 4 Region: 307-418
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000109
Family DnaQ-like 3'-5' exonuclease 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102246|ref|YP_003554104.1|
Sequence length 854
Comment DNA polymerase I [Aminobacterium colombiense DSM 12261]
Sequence
MNTLKDKTVLLVDGHALAFRAFYALPELTAPDGTPTNAILGFINMMFKTIDDCHPDMTAV
VFDAPGATFRHEIYPEYKMGRRPTPEEYKVQVPLLQQVVRAMGIKVVVKEGVEADDVIAS
AVCGAARLGVKVIALTSDKDILQVLQPGVRIIRPIKGVSTFTEYNEASFEEEWGFPPTVM
PDYLALLGDAVDNIPGVPGVGEKTAKKLLSQYVSLEDIYDHLDELKPGLQKKFIEAKETA
FKSRELIRLKCDLPLTVEEFTQTEVNFESFEELCRRLGLHKILERVRKSGEYETTKEEVQ
LEIGEAVEGNLAEILHEKELAFYCLPEGFYPMKLEKARIALRAQSGSYWHGVVNAHAAPA
SLLEWLKTGNVITSDYKMMQGFFKEDAPLSDRVWDAQIAHYLLHPDAKSHGPESWAAESI
ADPVEIAGQLWRVKNDLSSNIAQYQGLDKLMRDVEIPLIPVLWRMETWGIGLNRESFNGL
DSDLEIRIVEIEDTIAEKGGERINLNSPKQVAWLLFEKLNMPPIKETKTGYSTDVTVLEE
LVKMGLPEKEVPELILEHRELSKMRSGFVHPLVSAADENTDLIHGTFESTSTGTGRLSSR
DPNLQNLPAFGQWSTRLKEGLVPHKDGNIFVAADYSQVELRVLAHLCDEKRLKEAFEARR
DIHTETASWIFNVNPQMVTPELRRFAKVVNFGLLYGMSSFGLASRLGIGQQEAGDIINRY
FRALPKVRDYIEKSYQDARKRGYAVTDFGRIRPLDEVSVNPRDRGALKRIAVNTPIQGTA
ADIARMAMIKFYKHFEKRQNVHLVLQIHDSLVCECAAEEKEAVVKDLTDIMESAATLSVP
LKVEATWGHSLAEV
Download sequence
Identical sequences D5EFP8
gi|294102246|ref|YP_003554104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]