SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102287|ref|YP_003554145.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102287|ref|YP_003554145.1|
Domain Number 1 Region: 80-214
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-26
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 12-83
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.59e-16
Family GntR-like transcriptional regulators 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102287|ref|YP_003554145.1|
Sequence length 222
Comment GntR family transcriptional regulator [Aminobacterium colombiense DSM 12261]
Sequence
MGTQQIPEILQIARRITDVTREKILDGEIEEGQRLTESFLADMFGVSRSPIREALRMLAH
EGFVELLPYRGARVSVIRLKNVHEHYQLKAMLDGYGCYAAAQKLTEEDFATLANNIEESR
CYIEEGDFEGMVSANTAFHSLIIESIDNSLLSQYYNSISQNLRRYAELSLGNIDRWGDVI
DGHKAIYDALLNKDAVGAFEAANKHAFEAMDRVTHQIGKKNK
Download sequence
Identical sequences D5EFT9
gi|294102287|ref|YP_003554145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]