SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102320|ref|YP_003554178.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102320|ref|YP_003554178.1|
Domain Number 1 Region: 344-400,638-812
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-34
Family Tandem AAA-ATPase domain 0.0023
Further Details:      
 
Domain Number 2 Region: 251-465
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-23
Family Tandem AAA-ATPase domain 0.016
Further Details:      
 
Domain Number 3 Region: 113-199
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000879
Family Nuclease 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102320|ref|YP_003554178.1|
Sequence length 1065
Comment helicase domain-containing protein [Aminobacterium colombiense DSM 12261]
Sequence
MSTDLSFITNEENQNLKERFKILIKSTDFFDCLVGYFYSSGFHAIYPSLEDTQKIRILIG
ISTNRETFNVMEEANKATQQLFDFSHAETKQEVENLVLAEMEESEDNRNVEEGVHKFIEW
IKTGKLEIRAYPSKKIHAKLYIMTFSEDDRDRGRVITGSSNFTQAGLVDNLEFNVELKNR
SDYEFAKNKFDKLWADAVDVSEKYVQTIQDKTWLTQNVTPYELYLKFLYEYFKDELSQTD
EVFVRYLPQEFKRLEYQEQAVLNAKKIVLEYGGVFISDVVGLGKTYISAMLAGQLDGRTL
VIAPPVLLEKTNPGSWPNVFSDFRVPADYESIGRLDNLIERGTEKYTNIIIDEAHRFRTE
TTITYEKLAEICRGKRVILVTATPYNNSPKDILSLLKLFQKGQKSTIPNLPNLESFFNSL
DKKLKQLDRKKDYDKYIETVKENAREIRNKVLKYLMVRRTRAEIEEYFSRDIKEQGLKFP
KVAKPVPLFYELNEKEDFIFNRTIEHIANQFKYARYMPMLYYKNELNQLERQSQRNMGRF
MKILLVKRLESSFFAFRNTGQRFLNSYNMFLKELDDGFIYVSKKYSNKIFELLESDDDEA
LQKLIDEGKAERYSSEDFKDELRTDLEHDRAILMEIKRLWEQIDRDPKLLKFKKELSTNA
TLQKNHLIIFTESKETANYLFEEINKEYPKKVLLFTGDSKEAVRDKVIANFDARARSKKG
DYRILISTEVLSEGVNLHRSNVVVNYDIPWNPTRMMQRVGRINRVDTPFDVIHTFNFFPT
TQSNDQIKLKEAAEGKINAFLTLLGGDAELLTEGEPIGSHELFDRLTSAKTLEGNDESEE
SELKYLRVIQDIREKNAELFERIKRLPKKARTSKQKFESAGSLITYFRLGKLQKFFMSKD
KDEAQELDFMTAAKLLESNPEEKRKHIPGEIYDLLDKNKNAFIVATTEEVTKPQRGKGKD
SAANILKILKATMSNTQKFTEDQEDYLRKVFTQLEEGGLPKQTTKNTLQALQSLRKELVN
PLKVLAVLQANVPAGLLESHYAEQNPAASGKREVILSLYLAGEKE
Download sequence
Identical sequences D5EFX2
gi|294102320|ref|YP_003554178.1| WP_013048717.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]