SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102354|ref|YP_003554212.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102354|ref|YP_003554212.1|
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-79
Family G proteins 0.00000461
Further Details:      
 
Domain Number 2 Region: 474-594
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.03e-43
Family Translational machinery components 0.0000116
Further Details:      
 
Domain Number 3 Region: 595-687
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.21e-30
Family EF-G/eEF-2 domains III and V 0.000094
Further Details:      
 
Domain Number 4 Region: 263-399
Classification Level Classification E-value
Superfamily Translation proteins 9.51e-27
Family Elongation factors 0.00033
Further Details:      
 
Domain Number 5 Region: 399-477
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.69e-20
Family EF-G/eEF-2 domains III and V 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102354|ref|YP_003554212.1|
Sequence length 693
Comment translation elongation factor G [Aminobacterium colombiense DSM 12261]
Sequence
MGTRKPEDIRSVAIAAHGGAGKTSLVEAILFSNGDINRMGNVVDGNTVADFGAEEQKRQI
SINTALVTLERNGKRLYLLDTPGFADFIGEMRSAMRVSDSALAVVSGLHGVEVQTGKAYE
YAEDFSIPVAFVVSKLDRENSDYARTLDDIKKQLSDKAVPFFLPIGKEASFKGVVDILNQ
KAYEYVTDGSGSFKEISIPAEMVDEVSAARESLIESVVEADDEVMMMYLEGDEISHEEIV
KVARKAIRERQIFPVLPASGTANIGVHQVLDFLGDMFPSPLESRPRQALKGDEVINIDPD
PEAPFSALCFKIMVDPYVGKLSYIRVNSGHLSSDSSIYNVTREEEERISSFKAMRGKDGQ
DEKEIILGDIIAIPKLHSTQVGDTLGVKSTAYTFPPIKFPRPVYSVAVMAKSRADEDKLS
NALHKILEEDPVLTFAKNPETGDNVLSGMGDMHIEILLSRIRERYGVELETRTPQVPYRE
TIRKTAEAQGKYKKQTGGRGQYGDVHIRYKPLERGAGFVFEDQVVGGAIPKGFIPAVEKG
LREALVKGPLAGFPTVDFKAELFFGSYHDVDSSEMAFKIAASMSFKKGILEASPVLLEPI
MLVEVVVPEDYLGDVMGDMNSRRGRILGIDSHGRLQVVRVQVPLSEMFKYAIVLRSMTSG
RGTFTMEFDHYEEVPGDVSKKVIEEHKKEEEEE
Download sequence
Identical sequences D5EG06
WP_013048751.1.58668 gi|294102354|ref|YP_003554212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]