SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102358|ref|YP_003554216.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102358|ref|YP_003554216.1|
Domain Number 1 Region: 2-315
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6.3e-116
Family Adenylation domain of NAD+-dependent DNA ligase 0.0000000519
Further Details:      
 
Domain Number 2 Region: 403-582
Classification Level Classification E-value
Superfamily RuvA domain 2-like 5.56e-59
Family NAD+-dependent DNA ligase, domain 3 0.0000335
Further Details:      
 
Domain Number 3 Region: 317-399
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-26
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00042
Further Details:      
 
Domain Number 4 Region: 593-667
Classification Level Classification E-value
Superfamily BRCT domain 1.64e-18
Family DNA ligase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102358|ref|YP_003554216.1|
Sequence length 684
Comment NAD-dependent DNA ligase [Aminobacterium colombiense DSM 12261]
Sequence
MDRREALQRIEALREEINRHAHLYYVLDTPEIADHEYDALFRELASLEEAFPEFDDPDSP
THRVGGAPLDRFEKVIHESPLLSLDNALSKEEVWSFCDRVFSGLGLGNLEYLCELKIDGL
AVSLIYEDGVFIRGATRGDGLVGEDVTANLRTIRSLPLRLREKVSGRMEVRGEVLMTREQ
FAALNQEREEGGELLFANPRNAAAGSLRQLDSSITASRKLSIFLYYVAHPQEHGLRTQQE
VLHWLQHLGFPVQSAWGVCSTRQDIDAFIEEWREKRLSLPYSTDGVVLKINQVDFWEDLG
TTAKAPRWAIAFKYPPEEKTSRILDIEVSVGRTGTLTPVAHLEPVHLAGTVVRRASLHNE
DEIRRKDIRIKDKVVVRKAGEIIPEVVRVLTEGRDGNEVEFQMPDTCPACGSHVMRIPGE
VALRCPNRASCPAQLREGIAHFASRAAMDIRGLGDKLITQLVDRQLIRNMADLYTLKRED
LLSLDRMGEKSASNLLEALSVSKNRFLSNLITALGIRLVGKKVAEILADRFHSLDALSSA
QEEGLSSIDGVGPKIAASIKAFFDDEANKEMISRLKDAGVRVVEEKSMSSVEGPLEDQRF
VFTGELQSMSRGEAEALVKNLGGASSSSVSKKTSIVVAGPGAGSKLQKARELGITIINEE
EFLQMIRPYERVFSKHTDSIEKEE
Download sequence
Identical sequences D5EG10
WP_013048755.1.58668 gi|294102358|ref|YP_003554216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]