SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102409|ref|YP_003554267.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102409|ref|YP_003554267.1|
Domain Number 1 Region: 13-228,351-398
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-80
Family Tandem AAA-ATPase domain 0.000000131
Further Details:      
 
Domain Number 2 Region: 614-830,867-879
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 4.97e-62
Family Helical scaffold and wing domains of SecA 0.0000227
Further Details:      
 
Domain Number 3 Region: 400-612
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.62e-57
Family Tandem AAA-ATPase domain 0.00000094
Further Details:      
 
Domain Number 4 Region: 227-350
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 3.27e-42
Family Pre-protein crosslinking domain of SecA 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102409|ref|YP_003554267.1|
Sequence length 891
Comment preprotein translocase subunit SecA [Aminobacterium colombiense DSM 12261]
Sequence
MLKGLKRVLGLDPNERALKRYRQIADDINGLEPEYSAKSDEDLRSLVADFKRRANEGESL
DNLLVEVFALVREVSRRTLGLRHFDVQLMGGMALHEGKITEMKTGEGKTLVATLAVVLNA
LSGNGVHVVTVNDYLAKRDAEWMGPIYRFLGLSVKCIYAYMDQKERKEAYLSDVTYGTNS
EFGFDYLRDNMAVAKDQLVQRGHHFCIVDEVDSILIDEARTPLIISGPSEDNVEMYTTAD
QIARQLKEGRDFEKDEKERNVAFTEDGIARCENLLKMPGLFSDAANSDLAHRIVQAVKAH
VLFQKDVHYVVKDGEIIIVDEFTGRLMFGRRYSDGLHQAIEAKEKVRVGRESQTLATITL
QNYFRMYRKLAGMTGTAVTESEEFKEIYGLDVIVVPTNKPMVRSDFPDVIYRTSLEKFHA
VAEEVEETYSNGQPVLVGTTSIENSERISKLLKARKIPHQVLNAKYHEKEAQIVAQAGRF
GAVTVATNMAGRGTDIVLGGNPDFLAKETLRKEGNVEDLDPSKYQQLLEEYRQICAKERD
EVLDKGGLKIIGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDDLLRLFGSERIQGI
MEKLGMEEGEAIEHNLLTKAIESAQKKVEQMHFDIRRQLLSYDNVMNQQREAVYGERHRI
LEDKNIIDHTRDVATGVVDDVLNHYFPEEGEPEPERAEARLRGLFGPGFEPYLKSVDSSR
LLPEVSEQIKQEVESRFIRKIENLGPLVADELMRFIVLHTLDTSWKDHLLAMDELRRGIG
LRAIGQKDPLLEYQFESYNLFQSMMGRVRESISELAFRVTVVSEETRRSPDRQSLRESRD
FAMPILSREVPGAGVGTEKHQPIRKGPKVGRNDPCPCGSGKKYKYCCGKNA
Download sequence
Identical sequences D5EG61
WP_013048806.1.58668 gi|294102409|ref|YP_003554267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]