SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102417|ref|YP_003554275.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294102417|ref|YP_003554275.1|
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00306
Family Transcriptional factor domain 0.033
Further Details:      
 
Domain Number - Region: 48-94
Classification Level Classification E-value
Superfamily RecA protein, C-terminal domain 0.00876
Family RecA protein, C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102417|ref|YP_003554275.1|
Sequence length 153
Comment ATP-cone domain-containing protein [Aminobacterium colombiense DSM 12261]
Sequence
MRCPKCGAMETRVIETRTADEGRVVRRRRECPECLARFTTYEKVEEKRTLRVIKKNGSRE
IFDREKITRGISKACEKLPVSLEQIEEVASRIEESFRSGGYGEIPVSLIGERVMEELKQL
NKVAYVRFASVYREFTDLSSFQREISRLSGEKD
Download sequence
Identical sequences D5EG69
WP_013048814.1.58668 gi|294102417|ref|YP_003554275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]