SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102504|ref|YP_003554362.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102504|ref|YP_003554362.1|
Domain Number 1 Region: 8-602
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 6.67e-176
Family Prokaryotic type I DNA topoisomerase 0.00000000096
Further Details:      
 
Domain Number 2 Region: 584-626
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000139
Family PhnA zinc-binding domain 0.074
Further Details:      
 
Weak hits

Sequence:  gi|294102504|ref|YP_003554362.1|
Domain Number - Region: 629-667
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00391
Family PhnA zinc-binding domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102504|ref|YP_003554362.1|
Sequence length 711
Comment DNA topoisomerase I [Aminobacterium colombiense DSM 12261]
Sequence
MTKKESGKTLVVVESPTKAKTLSKILGSKYTVKASIGHIKDLPKSRIAIDVENNFQPEYI
LVKGKAKIKNELVKLARGSQKILLASDPDREGEAIAWHLCNILDVDPQTLCRIRFYEVTP
KAVKEALKKLEPVDMNRVNAQQARRVLDRLVGYTLSPLLWKKIRYGLSAGRVQSVALNLI
CEREREIISFVPSEYWHISVLASSLDKTRNYDLKVMSFKNKSFWKEGKPLLISSSEQAEK
IASDIAKQELVVKEYKVKEGKRAPLPPFKTSTLQQEAARRLGFSPRRTMRIAQSLFEGVS
VPGRGPVGLITYMRTDSLRIAPDAINGARTFISERYEAKYLPAKPNFFASKARSQDAHEA
IRPTDVTLTPEILKNVLNSEQHRLYTLIWNRFVASQMASALVANAILDVAAGSYGLRQTG
ESLIFDGWGAVWPLELKGGQLDPAQPEETLLCQEIEKEQRFTKPAARYSEATLIKTLEEK
GVGRPSTYATIVETLYDRGYVEKNEEKRIEPTQLGMTVDDFLLQYFDSKSQSPIVDTGFT
AQMEEQLDLIEEDQLQWVEVVRSFWNGFTNTLEEAKKASAVELPEPEPIGEDCPECGKPL
VKKRGRFGEFIACSGYPECRYTKPILKTIGVKCPLCGETEGGEVVRRRSKKGKFFYGCSR
YPECKYVSWNEPTGEKCKECGASLIRKNKKSLPECPECGWKKEKKGKKENK
Download sequence
Identical sequences D5EGF6
gi|294102504|ref|YP_003554362.1| WP_013048901.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]