SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102506|ref|YP_003554364.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102506|ref|YP_003554364.1|
Domain Number 1 Region: 80-272
Classification Level Classification E-value
Superfamily MCP/YpsA-like 9.55e-34
Family MoCo carrier protein-like 0.016
Further Details:      
 
Weak hits

Sequence:  gi|294102506|ref|YP_003554364.1|
Domain Number - Region: 302-361
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0126
Family Plant O-methyltransferase, N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102506|ref|YP_003554364.1|
Sequence length 368
Comment DNA protecting protein DprA [Aminobacterium colombiense DSM 12261]
Sequence
MTPRQQALLLMNALEADSRLWNRLVATEESMEALLSANLTEEQRGALSPGACERIVSLIR
SKWVKRQENRWHSMGIQVLYYGEKGYPPSLQTMENAPLVLFVRGRSRLEKPMLAVVGTRR
STFYGQQVARALGRVAAERGCILLSGGALGIDGAAHGGCLESGGETAVILAHGHNRIYPR
QHKDLFSKIVGSGALITEYGLGVDAKPWHFPKRNRIIAGLADVIVVVEAPVRSGAIVTAQ
LALDLGKEIWAVPGRIDEKVCKGSNKLLFDGANPLIDVSDFAETLCSKQLDLWGSDVRKN
RQNQLDITEKEQKILNLFQIHGDRTVDNLSAECKMTAADVISCISHLSALNLIYQSGPGR
WRASIDPK
Download sequence
Identical sequences D5EGF8
WP_013048903.1.58668 gi|294102506|ref|YP_003554364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]