SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102560|ref|YP_003554418.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102560|ref|YP_003554418.1|
Domain Number 1 Region: 7-243
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-71
Family LplA-like 0.00000593
Further Details:      
 
Domain Number 2 Region: 245-327
Classification Level Classification E-value
Superfamily SufE/NifU 0.0000000000000068
Family SP1160 C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102560|ref|YP_003554418.1|
Sequence length 335
Comment lipoyltransferase and lipoate-protein ligase [Aminobacterium colombiense DSM 12261]
Sequence
MLKVKTFLAESPFVDPRINLAIEEHLLSHLSSHSVILYLWQNEHTVVIGRNQNAWKECRT
SLLSEEKGTLVRRLSGGGAVYHDLGNLNFTFLASHLSYDFIRHIKVLVAAFRSIGIPASF
SGRNDIFVENRKVSGNAFYQGKAGRYHHGTILIDVDIDRMVRYLQPPAAKLKAKGIDSVK
SRVANLKEFNTSLSIDVVKKAIKASFLEEYGGEGENISLSDIMKKEEVKTLYKKYSNPSW
IYGLSPDFDVEIENRFDWGHVALGFHVREGSVSQCHIYSDAMDGDLIASLAPFLKGVPLQ
GDVLAKALRRNFPESMPQEVQEMACWLEKDWAHMF
Download sequence
Identical sequences D5EGL2
gi|294102560|ref|YP_003554418.1| WP_013048957.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]