SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102602|ref|YP_003554460.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102602|ref|YP_003554460.1|
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-56
Family G proteins 0.00013
Further Details:      
 
Domain Number 2 Region: 415-529
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.15e-28
Family EF-G/eEF-2 domains III and V 0.0092
Further Details:      
 
Domain Number 3 Region: 154-308
Classification Level Classification E-value
Superfamily Translation proteins 2.37e-24
Family Elongation factors 0.011
Further Details:      
 
Domain Number 4 Region: 320-404
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000255
Family EF-G/eEF-2 domains III and V 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102602|ref|YP_003554460.1|
Sequence length 621
Comment GTP-binding protein TypA [Aminobacterium colombiense DSM 12261]
Sequence
MVQAEKIRNLAIIAHIDHGKTTLIDSIFKAAQIFRKGAHIEERVMDSNELERERGITIRA
KHCTVEWNGYLINIIDTPGHADFSGEVERVLSTVDSVLLLVDANEGPMPQTRYVLMRALA
MGLRPIVFINKVDRPHANPMSALNQTFDLFIELGAAEEQLDFPVLYGSGLDGWAVRDLNK
YAHEGMKHLFETIAEYVPAPKVNLHAPFLMQVSTLAWNEYTGRIGCGKVLQGTLRKGENF
IRYSTKWKKPNLRGEEWEICDEEQTRSVKMWVTRGLERQEVEEISAGDIVWISGPQEINI
GDTFCSPELEGKTLPPLAIEEPTVSMFFLVNTGPFSGQEGQPITLRQLKARLEREKHVNV
ALRVEDIGRPDGVKVSGRGELHLSILIEEMRREGLEFCVSKPEVITREEDGRTFEPMEDL
TIDVPEEYQGVVFEKLSRRKARLVSMDNTQTGLVRLSFQIPTRGLIGYRGEFLTDTRGLG
IMNTVFAGYGPWVGTISPRNRGSLVSLDTGEATSYQLENLQERGTLFIEPGELVYEGMIV
GENSRPGDMPCNPTKKKQATNHRSATKDLTTKLDVPRKMSLEKAMEWIAEEELVEVTPQS
VRMRKAVLDYQERRKSTKKAS
Download sequence
Identical sequences D5EGQ4
gi|294102602|ref|YP_003554460.1| WP_013048999.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]