SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102603|ref|YP_003554461.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102603|ref|YP_003554461.1|
Domain Number 1 Region: 637-787
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.28e-41
Family GGDEF domain 0.00011
Further Details:      
 
Domain Number 2 Region: 96-259
Classification Level Classification E-value
Superfamily GAF domain-like 9.6e-22
Family GAF domain 0.0045
Further Details:      
 
Domain Number 3 Region: 302-474
Classification Level Classification E-value
Superfamily GAF domain-like 1.81e-19
Family GAF domain 0.0056
Further Details:      
 
Domain Number 4 Region: 448-617
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000000198
Family GAF domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102603|ref|YP_003554461.1|
Sequence length 794
Comment GAF sensor-containing diguanylate cyclase [Aminobacterium colombiense DSM 12261]
Sequence
MKDWLGSILFLLVSAAGFFFGKGLGCGIFLFPATLLVFLLAFSIYGTKRANGIMLLFVSV
LVPAHIIFFHFPLRIALPLYVMIFAVYCLSEFLRRQSAKEMAVFLDYIKQAGSASTIEKV
CVPALDLIKRLMPDSAPAVALYDKKRNLFQILSAHDEYTGEGVSPDGTVPFENHVYSRVF
VSGKPLIVDDIRSHPPYVEGTPGARSGLVVPIVWRDQKSGVIVVESRKLARFSSTDLRGL
QFFAVILGEILTHLQVEQKLEANVAELKRTNEAFSSTQKALSNALDVSREQKANLEVLLK
KFRDLFDIVQGMSLCRSAEELFSLVSWQLSQRLGYKNVYVFSRESFSKEITLQTWVGKLP
EELKDLKGLEKGILLHVLETGEPYLATDVSKDSLYLNLDSDVRCQLIVPVISSNGLWGAV
AVDDDVIGGITNQDQELLGVIAAHMALELENKESFARLNVEVNRLRTLLDIVQSFSVERA
DFEQVAPHVVQMLTSVFNYEKISIFRVEKKEDASFFLRALASNFVSMADLDEYSQKLYEN
GGGLVIRCAERGEIINTPNLAASSYYVNLSSKSTTSQLDIPILFGGEVFAVISMEKNSPF
VKSDEGFFMILSKHLAALVAVQTAIEETKRKALIDDLTQLWNRRFLSMRIAEEQSRHERF
GDPASMVMIDMANFKLINDTYGHLVGDKVLKSFASLLSECVRAGDIAGRFGGDEFLLILP
GTVQKQAFHLVKRLQSSLEALHVEGVLHNISADFGVATVPEDASSLHEALKIADDRMYQS
KVERRRRQEENKGT
Download sequence
Identical sequences D5EGQ5
WP_013049000.1.58668 gi|294102603|ref|YP_003554461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]