SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102629|ref|YP_003554487.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102629|ref|YP_003554487.1|
Domain Number 1 Region: 394-627
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.02e-92
Family Type II DNA topoisomerase 0.00023
Further Details:      
 
Domain Number 2 Region: 7-219
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.5e-70
Family DNA gyrase/MutL, N-terminal domain 0.000000845
Further Details:      
 
Domain Number 3 Region: 222-392
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-55
Family DNA gyrase/MutL, second domain 0.00000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294102629|ref|YP_003554487.1|
Sequence length 634
Comment DNA gyrase subunit B [Aminobacterium colombiense DSM 12261]
Sequence
MTTSAKQYTAKDIQVLEGLQAVRKRPGMYIGDTGPRGLHHLVYEVVDNSIDEAIAGYCDK
ISVVIYEDESVSVADNGRGIPTEPHPSSGRPASEVVLTILHAGGKFDNQAYKVSGGLHGV
GVSVVNALSEWLEITIQRNGLSRTQRFERGVPVTDLSEGEPSTKTGTYVRFHPDTTIFEE
VRFSADILSGRLREMAFLNPGLAITLEDHRSGKCVEFHYEGGIKTFIEYLNKGKTPLFPE
PIVIAGEKDGASVEIGIQYNDGYLERIFAFANMIHTIEGGTHVAGFRTALTRAVNEVARR
AKILREKDENLSGEDLKEGLTCVLSIKLSNPQFEGQTKTKLGNSEIKGITDSVVYEGLLA
YLDEHQEVLKPVVEKAIRARQARDAAKKARELVRKTAMTGMNLPGKLADCSSRDPHVCEV
YIVEGDSAGGSAKQGRDRGFQAILPLRGKILNVEKARFDKVLSNNEIRTIIQALGCGIGE
DFDHSKLRYNKIIIMTDADVDGAHISTLLLTFFYRYMQDLIDKGHLYLAQPPLYRVQRGK
NVTYCYSEKELRDIVDSTPDSRRASVQRYKGLGEMNPDQLWETTMDPQNRVLKRIEVEDA
MLADEYFSILMGDKVEPRRDFIAAHAHEVRNLDI
Download sequence
Identical sequences D5EGT1
WP_013049025.1.58668 gi|294102629|ref|YP_003554487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]