SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294102759|ref|YP_003554617.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102759|ref|YP_003554617.1|
Domain Number 1 Region: 1-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-59
Family ABC transporter ATPase domain-like 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102759|ref|YP_003554617.1|
Sequence length 260
Comment ABC transporter-like protein [Aminobacterium colombiense DSM 12261]
Sequence
MIEIVDLSITYKTESHDVSAVKNAFLSIPRGRITGLVGESGSGKSSLLMAIPGLLPSNTE
VSGAVIFDNLNLISLRPEMLNAIRWKDIALIPQGAMNSFTPVLTIGKHIEEVLAIHLGLS
GEARRHRCRSLLEEADLEWSLANRYPHELSGGQKQRAAIATALACDPDFLLADEPTTALD
VITQKEIILTLERLARGRNMGLLLVTHDLPLAVQICDAIAVMHEGEIVEEGAPADIVTKP
RHRHTTQLVKALLELEGEYV
Download sequence
Identical sequences D5EH61
gi|294102759|ref|YP_003554617.1| WP_013049155.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]