SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102787|ref|YP_003554645.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102787|ref|YP_003554645.1|
Domain Number 1 Region: 1-51,818-1007
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000568
Family ABC transporter ATPase domain-like 0.044
Further Details:      
 
Weak hits

Sequence:  gi|294102787|ref|YP_003554645.1|
Domain Number - Region: 565-703
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0366
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 
Domain Number - Region: 775-830
Classification Level Classification E-value
Superfamily HR1 repeat 0.0418
Family HR1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294102787|ref|YP_003554645.1|
Sequence length 1038
Comment hypothetical protein [Aminobacterium colombiense DSM 12261]
Sequence
MRFIEFKIRSFGLLENMEGHFPAGLSLILGDNESGKTTLMSFLRYSLFGCPDGRSSRNLY
APPHGGKQKGSLIIESLKGERFSLVMNGRNSTFSGARNGTSLEDLLGYVDREMYERIFSV
GLEDMQKIRPLNDRGIQSRFFSAGAGLGTASLPTFLASLSNQEKALYRIQGGARSSAEIN
VFLKKIQETKEQIKLLQQQKDEYLQKKEELEKTGHQIESARKNLEAIRYDLSLMEWVEKA
RSPWVEMTEAQRKLEEIGEVLFFPDEGLLRFKKIHEEEGARERELEELVFQCRNLDKQLQ
AFHIPSIQKVLEQKGAIRALAQNRNRIEKEEEIIQNLSLDILSMKQRLDREVREIHQSWT
IDDLESLDLSFGVSQKAGDLEKQKEDFRNQHVIRNETCEQARKARDEARSLLKTRKEHVE
KMERNVSPLSVQTLREKCGSLRQFFTRWHQIQNQIKENEMNLDLFRQKKELQWGGAAAGT
LGLAFLGAGYRTGDIFFLKTGITAIAASLGFIIVDFFQKRKFFNEKEELLCRLRKNLVET
EEELSHTVEGLAIECPKDYLELEKAEMYIDDCIDGIREYDQALQSQRDAEEELGRRQRKL
EDCESSLNSIKKLLDQTDAEWKSFVEEKGFSASLKVEHWTEFESLVKQLRGRLAQIRDME
KQLSSSQEYISAKEEEIHSLFRSLSLGPWSKLSLVSPIDILTSRLEEAEEQWNQITMIQR
EKKRNEEIYERAHKAWNESRTLKKELFEQAKVHDEPSFLELGERWQRCNDLKKIIENHRL
SLLAIAGGNENLTKVLEELPKRTPAESQILIGESKEQEQLLSQQLEELNEERGHLKTRID
ELEKDKELSALFLEREKLEEELRLALKEWLAVVACRCVLEQTRQKHEQERQPEVFKKAGD
FLELMTEGRYSLISTASEEGGFSVELEEKSGFLRKKEDVWSSGLADQVYLSIRLALAELY
GKRMEPLPLILDDVFVRFDERRQIGAARVVLDVASRGQILLFSCRRDIEDVFLEARDGMA
HKFSTYEMKNGKIFSVQP
Download sequence
Identical sequences D5EH89
WP_013049183.1.58668 gi|294102787|ref|YP_003554645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]