SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294102815|ref|YP_003554673.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294102815|ref|YP_003554673.1|
Domain Number 1 Region: 66-254
Classification Level Classification E-value
Superfamily GAF domain-like 1.63e-38
Family IclR ligand-binding domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.4e-18
Family Transcriptional regulator IclR, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294102815|ref|YP_003554673.1|
Sequence length 264
Comment IclR family transcriptional regulator [Aminobacterium colombiense DSM 12261]
Sequence
MEKDRYLNQSIIRALRILELFAQREEPLGVTEISRLVGLHKSTVHRLVITLETSGWLLRM
PETDKYRIGLKLIAVGKKAVSDANSITAIHPILEKLTQITGETSILTMVMGNQAICVDKV
ETSQRLMISSQVGQSSPLHAGATGFAVLIGMPEEEAFRTLSHDLPLPVYTDKTPTCMEEL
RERYKERRENGYVIASGEVDPGTTGIAVPLYFPYERCYGSLGVVLPDYRADEEKIQRVLA
AVQQGACEARKRLDWGFEGPCKNM
Download sequence
Identical sequences D5EHB7
gi|294102815|ref|YP_003554673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]