SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101094|ref|YP_003552952.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101094|ref|YP_003552952.1|
Domain Number 1 Region: 173-332
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 1.44e-22
Family YbaK/ProRS associated domain 0.0018
Further Details:      
 
Domain Number 2 Region: 403-498
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-18
Family Anticodon-binding domain of Class II aaRS 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|294101094|ref|YP_003552952.1|
Domain Number - Region: 38-186
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00497
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101094|ref|YP_003552952.1|
Sequence length 509
Comment YbaK/prolyl-tRNA synthetase associated domain-containing protein [Aminobacterium colombiense DSM 12261]
Sequence
MRMTTLLTPTLKKEPAGWQDPGAIRLLRGGYALDLHHGEWSLLPLGALLRDNVAWTFIHA
FMDGGFQQLEDLLYRKEGIQLLAQRVVQSYRDLPLRVMELRGGRLLLSGIEASSSEECQK
NLLYFIENLLENMALSGVKIEDATLGKEGAYIALHAEEEFAASSEGVECPSCGWHGTTHA
HAGETKPFRTEEESSVQEVFTPGAESIDALCSYLEVSSEQTIKTMFYMAEVNGVFQPVTV
LIRGDRQISERKLLVSLGATEVRIAEEKELIEIMGQKPGFLGPVGLPDKLLVIADSSVEG
CKGVVTGANRPEYHLTGVTWGRDFKTERVADIALLEEGMDCPHCGSALRKYLWNGVAAVW
GEPEDALETLYQDQSGSSQKCALWKGWIHLDSIITALARQKTYPLGLAPFDVDIIVPSIK
DETAMELATNLYHEMVHQGVVALFDDRNERAGAKFADFELFGIPAKVVVGRKAAEGIVEV
QYGEEVKEMQACHVTCFLSSLLNDDDTQL
Download sequence
Identical sequences D5ECE6
gi|294101094|ref|YP_003552952.1| WP_013047494.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]