SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101302|ref|YP_003553160.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101302|ref|YP_003553160.1|
Domain Number 1 Region: 9-451
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 2.49e-101
Family Putative modulator of DNA gyrase, PmbA/TldD 0.00000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101302|ref|YP_003553160.1|
Sequence length 452
Comment peptidase U62 modulator of DNA gyrase [Aminobacterium colombiense DSM 12261]
Sequence
MIVPDRDEVESYAELAIKEALEKGACGADILFYFGSSHSLSLRDEKPEQNNSGFSVGVGI
RTLDRDGRQGVAHINTFNRSSLQQLVEWSWHNCANLEPDPWTVLYNGKSSYAKNLELKDE
KISAILPEQRQEWCAEMTHLAKKKDSRVLSVRSASWNDGEGATFYMASTGVKGWYDGSGV
AAGLSLVMSDGVNMEMGGYGEDFRFLEDISLQRIVEKAVTQTACTLGGRPIQTKRYTLVL
SPEVSASLLSVIGELFCASNVHKNRSLYKGKLGKKVASPLLSLVDDGLMPRKLGTVPFDG
EGVPSQRTVLMKEGIVEGYLYNLKHAQKDGVESTGNAARSISSLPDVDISNFYMEPGNIS
SEEIFVSVQSGIYITEFLGLHTVNPVSGDFSLGIKGVSLSGGLFAQPVAGMTIAGNLLDL
LNRIVFIGNDLSFFGDTGGCTMVIDNVTAAGL
Download sequence
Identical sequences D5ED04
WP_013047702.1.58668 gi|294101302|ref|YP_003553160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]