SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101780|ref|YP_003553638.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101780|ref|YP_003553638.1|
Domain Number 1 Region: 2-178,397-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-44
Family ABC transporter ATPase domain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 584-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-43
Family ABC transporter ATPase domain-like 0.0028
Further Details:      
 
Weak hits

Sequence:  gi|294101780|ref|YP_003553638.1|
Domain Number - Region: 218-262
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0732
Family Pyk2-associated protein beta ARF-GAP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101780|ref|YP_003553638.1|
Sequence length 920
Comment excinuclease ABC subunit A [Aminobacterium colombiense DSM 12261]
Sequence
MVITGPSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLGIQKKPDVDDISGLSPAISIE
QKGTSHNPRSTVGTVTEIYDYLRLLYGRLGVPYCPSCGKAVIRYSLDEIVDVIFRNYPDQ
RLEILSPQVRGKKGEFKNLFAQNREKGFMRVRVDGTIYWLEEEIALDKNKRHTIEVVIDR
LKVLDDRKGRISEAVEAALSLSGGYVLLVTEGGKEQLLTENYACPDCGISLPEIEPRLFS
FNNPYGACPDCSGLGSHEHFSEEHAIDPVRSVEEGALLPWKKKHYMLRKLYTFSQSKEWD
LTQPYGTLPKNVQNFILYGSDERLPMFFSDRGERHQYMGRYEGLLPWLEGRWNETESENV
LEELAGYRVEDICQTCHGYRLRPEALMVQLNHHTIDELVEMPVDRLLPVLKEMEFTENEQ
KIMGQVMIELEKRLSFLVDVGVGYLSLMRRADTLSGGESQRIRLATQIGSKLSGVLYVLD
EPTIGLHSRDTDRLLRTLRSIRDLGNTVVVVEHDRETMLAADAIVEMGPGAGEQGGEIVN
AGTAEEVLNTNALTGPYLRGEVSGCIRRRDVRNTSHWLTLRKVAHHNLKEIDVAIPSRVF
SCISGVSGSGKSSLLYDVLYKGMKRILDKDFRERAGKHLSIDGAEQFRNVVLVDQSPIGR
TPRSNPATYTGLFTLIRELFAELPESKIRGYAPGRFSFNVRGGRCEACSGAGSVKVSMLF
LPDVYVDCEVCGGTRYNRETLEVRYKGRNIADVLNMTVDDAFEFFKEIPRIASKLALIQE
AGLGYIRLGQSALTLSGGEAQRVKLAKELSKRFTGPTLYLLDEPTTGLFYTDVKKLLHIL
HRIVDQGNTVVTIEHNLDVLLSSDYIIDLGPEGGMEGGSIVTQGTPEEIIKSRQGYTSAY
LQEYARQLEREDHYERKTAS
Download sequence
Identical sequences D5EED2
gi|294101780|ref|YP_003553638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]